PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_37844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 217aa    MW: 25165.2 Da    PI: 6.759
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_37844.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1761.1e-5461331128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                   lppGfrFhPtdeelv++yLk+kv+g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd+++   
  MLOC_37844.1   6 LPPGFRFHPTDEELVNYYLKRKVHGQSIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGCRTNRATRAGYWKSTGKDRSINY- 100
                   79****************************.99**************84335556888*************************************9. PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   +++ +g+kktLvfy+grap+g +++Wvmheyr+
  MLOC_37844.1 101 QKRSIGMKKTLVFYQGRAPQGIRSNWVMHEYRI 133
                   9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-644157IPR003441NAC domain
PROSITE profilePS5100559.7656156IPR003441NAC domain
PfamPF023651.3E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKVHG QSIELDIIPE VDLYKCEPWE LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRSINY QKRSIGMKKT LVFYQGRAPQ  120
GIRSNWVMHE YRIEESECNN TMGVQDSYAL CRVFKKNVPA GEFEKQGECS SSQAKGNQEQ  180
VTDFEEAGES SAANENDKDN SWMQFIVEDL WCSNKTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-56116015172NAC domain-containing protein 19
3swm_B6e-56116015172NAC domain-containing protein 19
3swm_C6e-56116015172NAC domain-containing protein 19
3swm_D6e-56116015172NAC domain-containing protein 19
3swp_A6e-56116015172NAC domain-containing protein 19
3swp_B6e-56116015172NAC domain-containing protein 19
3swp_C6e-56116015172NAC domain-containing protein 19
3swp_D6e-56116015172NAC domain-containing protein 19
3ulx_A5e-56215611168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1375961e-50AC137596.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 9 clone OSJNBb0031H05, complete sequence.
GenBankAP0055641e-50AP005564.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1228_C03, complete sequence.
GenBankAP0149651e-50AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126171e-50CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238477.11e-157PREDICTED: NAC domain-containing protein 86-like
SwissprotQ9FFI52e-87NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM0VW951e-165M0VW95_HORVD; Uncharacterized protein
STRINGMLOC_37844.11e-164(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-108NAC domain containing protein 57